Lineage for d2zfka1 (2zfk A:6-352)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111569Protein Kinesin [52646] (7 species)
  7. 2111610Species Mouse (Mus musculus), kif1a [TaxId:10090] [64017] (9 PDB entries)
    Uniprot P33173 3-355
  8. 2111618Domain d2zfka1: 2zfk A:6-352 [154416]
    automatically matched to d1vfva_
    complexed with adp, mg, trs

Details for d2zfka1

PDB Entry: 2zfk (more details), 3.61 Å

PDB Description: crystal structure of the kif1a motor domain during mg release: mg- releasing transition-2
PDB Compounds: (A:) Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C

SCOPe Domain Sequences for d2zfka1:

Sequence, based on SEQRES records: (download)

>d2zfka1 c.37.1.9 (A:6-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
vkvavrvrpfnsremsrdskciiqmsgstttivnpkqpketpksfsfdysywshtspedi
nyasqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlced
lfsrindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlskla
vtsyndiqdlmdsgnkprtvaatnmnetssrshavfniiftqkrhdaetnittekvskis
lvdlagseradstgakgtrlkeganinkslttlgkvisalaemdsgpnknkkkkktdfip
yrdsvltwllrenlggnsrtamvaalspadinydetlstlryadrak

Sequence, based on observed residues (ATOM records): (download)

>d2zfka1 c.37.1.9 (A:6-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]}
vkvavrvrpfnsremsrdskciiqgstttivnpkqpketpksfsfdysywshtspediny
asqkqvyrdigeemlqhafegynvcifaygqtgagksytmmgkqekdqqgiipqlcedlf
srindttndnmsysvevsymeiycervrdllnpknkgnlrvrehpllgpyvedlsklavt
syndiqdlmdsgnkprtvnetssrshavfniiftqkrhdaetnittekvskislvdlags
eeganinkslttlgkvisalaemdsgpdfipyrdsvltwllrenlggnsrtamvaalspa
dinydetlstlryadrak

SCOPe Domain Coordinates for d2zfka1:

Click to download the PDB-style file with coordinates for d2zfka1.
(The format of our PDB-style files is described here.)

Timeline for d2zfka1: