Lineage for d2zfhe_ (2zfh E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950805Protein Mammalian CutA-like protein [102975] (2 species)
  7. 2950806Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
    Uniprot O60888 40-146
  8. 2950811Domain d2zfhe_: 2zfh E: [154412]
    automated match to d1osce_

Details for d2zfhe_

PDB Entry: 2zfh (more details), 2.05 Å

PDB Description: Crystal structure of putative CutA1 from Homo sapiens at 2.05A resolution
PDB Compounds: (E:) CutA

SCOPe Domain Sequences for d2zfhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfhe_ d.58.5.2 (E:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
gyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlm
miktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvt

SCOPe Domain Coordinates for d2zfhe_:

Click to download the PDB-style file with coordinates for d2zfhe_.
(The format of our PDB-style files is described here.)

Timeline for d2zfhe_: