Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
Protein Mammalian CutA-like protein [102975] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries) Uniprot O60888 40-146 |
Domain d2zfhe_: 2zfh E: [154412] automated match to d1osce_ |
PDB Entry: 2zfh (more details), 2.05 Å
SCOPe Domain Sequences for d2zfhe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zfhe_ d.58.5.2 (E:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]} gyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlm miktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvt
Timeline for d2zfhe_: