SCOPe 2.06: Domain d2zfhd_: 2zfh D:

Lineage for d2zfhd_ (2zfh D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Mammalian CutA-like protein [102975] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
   Uniprot O60888 40-146

8. Domain d2zfhd_: 2zfh D: [154411]
   automated match to d1osce_

Details for d2zfhd_

PDB Entry: 2zfh, 2.05 Å

PDB Description: Crystal structure of putative CutA1 from Homo sapiens at 2.05A resolution

PDB Compounds: (D:) CutA

SCOPe Domain Sequences for d2zfhd_:

Sequence; same for both SEQRES and ATOM records:

>d2zfhd_ d.58.5.2 (D:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
gyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlm
miktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvt

Timeline for d2zfhd_:

• d2zfhd_ first appeared in SCOP 1.75, called d2zfhd1
  
• d2zfhd_ appears in SCOPe 2.05
  
• d2zfhd_ appears in SCOPe 2.07
  
• d2zfhd_ appears in the current release, SCOPe 2.08