Lineage for d2zfhc_ (2zfh C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557585Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2557670Protein Mammalian CutA-like protein [102975] (2 species)
  7. 2557671Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
    Uniprot O60888 40-146
  8. 2557674Domain d2zfhc_: 2zfh C: [154410]
    automated match to d1osce_

Details for d2zfhc_

PDB Entry: 2zfh (more details), 2.05 Å

PDB Description: Crystal structure of putative CutA1 from Homo sapiens at 2.05A resolution
PDB Compounds: (C:) CutA

SCOPe Domain Sequences for d2zfhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfhc_ d.58.5.2 (C:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvt

SCOPe Domain Coordinates for d2zfhc_:

Click to download the PDB-style file with coordinates for d2zfhc_.
(The format of our PDB-style files is described here.)

Timeline for d2zfhc_: