Lineage for d2zfhb_ (2zfh B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. Protein Mammalian CutA-like protein [102975] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
    Uniprot O60888 40-146
  8. Domain d2zfhb_: 2zfh B: [154409]
    automated match to d1osce_

Details for d2zfhb_

PDB Entry: 2zfh (more details), 2.05 Å

PDB Description: Crystal structure of putative CutA1 from Homo sapiens at 2.05A resolution
PDB Compounds: (B:) CutA

SCOPe Domain Sequences for d2zfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfhb_ d.58.5.2 (B:) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
gyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlm
miktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvt

SCOPe Domain Coordinates for d2zfhb_ are not available.

Timeline for d2zfhb_:

Domains from other chains:
(mouse over for more information)
d2zfha_, d2zfhc_, d2zfhd_, d2zfhe_, d2zfhf_