![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (5 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins) |
![]() | Protein Mammalian CutA-like protein [102975] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries) Uniprot O60888 40-146 |
![]() | Domain d2zfha1: 2zfh A:63-169 [154408] automatically matched to d1xk8d_ |
PDB Entry: 2zfh (more details), 2.05 Å
SCOP Domain Sequences for d2zfha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zfha1 d.58.5.2 (A:63-169) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]} yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte
Timeline for d2zfha1: