Lineage for d2zfha1 (2zfh A:63-169)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861689Superfamily d.58.5: GlnB-like [54913] (5 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 861745Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 861783Protein Mammalian CutA-like protein [102975] (2 species)
  7. 861784Species Human (Homo sapiens) [TaxId:9606] [117946] (2 PDB entries)
    Uniprot O60888 40-146
  8. 861785Domain d2zfha1: 2zfh A:63-169 [154408]
    automatically matched to d1xk8d_

Details for d2zfha1

PDB Entry: 2zfh (more details), 2.05 Å

PDB Description: Crystal structure of putative CutA1 from Homo sapiens at 2.05A resolution
PDB Compounds: (A:) CutA

SCOP Domain Sequences for d2zfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zfha1 d.58.5.2 (A:63-169) Mammalian CutA-like protein {Human (Homo sapiens) [TaxId: 9606]}
yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
iktqsslvpaltdfvrsvhpyevaevialpveqgnfpylqwvrqvte

SCOP Domain Coordinates for d2zfha1:

Click to download the PDB-style file with coordinates for d2zfha1.
(The format of our PDB-style files is described here.)

Timeline for d2zfha1: