SCOP 1.75: Domain d2zfda1: 2zfd A:32-214

Lineage for d2zfda1 (2zfd A:32-214)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin B-like protein 2 [101182] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101183] (2 PDB entries)

8. Domain d2zfda1: 2zfd A:32-214 [154406]
   automatically matched to d1uhna_
   complexed with acy, ca

Details for d2zfda1

PDB Entry: 2zfd, 1.2 Å

PDB Description: The crystal structure of plant specific calcium binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14

PDB Compounds: (A:) calcineurin B-like protein 2

SCOP Domain Sequences for d2zfda1:

Sequence; same for both SEQRES and ATOM records:

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
ttf

Timeline for d2zfda1:

• d2zfda1 is new in SCOP 1.75
  
• d2zfda1 appears in SCOPe 2.01
  
• d2zfda1 appears in the current release, SCOPe 2.08, called d2zfda_