Lineage for d2zeqa2 (2zeq A:3-78)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932359Protein Ubiquitin-like domain of parkin [89831] (2 species)
  7. 2932363Species Mouse (Mus musculus) [TaxId:10090] [89833] (2 PDB entries)
  8. 2932364Domain d2zeqa2: 2zeq A:3-78 [154405]
    Other proteins in same PDB: d2zeqa3
    automated match to d1mg8a_

Details for d2zeqa2

PDB Entry: 2zeq (more details), 1.65 Å

PDB Description: Crystal structure of ubiquitin-like domain of murine Parkin
PDB Compounds: (A:) E3 ubiquitin-protein ligase parkin

SCOPe Domain Sequences for d2zeqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zeqa2 d.15.1.1 (A:3-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]}
mivfvrfnssygfpvevdsdtsilqlkevvakrqgvpadqlrvifagkelpnhltvqncd
leqqsivhivqrprrr

SCOPe Domain Coordinates for d2zeqa2:

Click to download the PDB-style file with coordinates for d2zeqa2.
(The format of our PDB-style files is described here.)

Timeline for d2zeqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zeqa3