Lineage for d2zdra2 (2zdr A:2-281)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098260Family c.1.10.6: NeuB-like [110368] (3 proteins)
    Pfam PF03102
  6. 2098261Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (1 species)
  7. 2098262Species Neisseria meningitidis [TaxId:487] [117381] (4 PDB entries)
    Uniprot Q57265
  8. 2098263Domain d2zdra2: 2zdr A:2-281 [154399]
    Other proteins in same PDB: d2zdra1
    automated match to d1xuua2
    complexed with mg, mpd

Details for d2zdra2

PDB Entry: 2zdr (more details), 1.85 Å

PDB Description: crystal structure of sialic acid synthase (neub) from neisseria meningitidis in complex with mg2+ and (4s)-2-methyl-2,4-pentanediol
PDB Compounds: (A:) Capsule biosynthesis protein

SCOPe Domain Sequences for d2zdra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOPe Domain Coordinates for d2zdra2:

Click to download the PDB-style file with coordinates for d2zdra2.
(The format of our PDB-style files is described here.)

Timeline for d2zdra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zdra1