Lineage for d2zdra1 (2zdr A:282-349)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427209Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2427210Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 2427211Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species)
  7. 2427212Species Neisseria meningitidis [TaxId:487] [117331] (4 PDB entries)
    Uniprot Q57265
  8. 2427213Domain d2zdra1: 2zdr A:282-349 [154398]
    Other proteins in same PDB: d2zdra2
    automated match to d1xuua1
    complexed with mg, mpd

Details for d2zdra1

PDB Entry: 2zdr (more details), 1.85 Å

PDB Description: crystal structure of sialic acid synthase (neub) from neisseria meningitidis in complex with mg2+ and (4s)-2-methyl-2,4-pentanediol
PDB Compounds: (A:) Capsule biosynthesis protein

SCOPe Domain Sequences for d2zdra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zdra1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOPe Domain Coordinates for d2zdra1:

Click to download the PDB-style file with coordinates for d2zdra1.
(The format of our PDB-style files is described here.)

Timeline for d2zdra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zdra2