SCOPe 2.07: Domain d2zdra1: 2zdr A:282-349

Lineage for d2zdra1 (2zdr A:282-349)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (2 families)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
   Pfam PF01354

6. Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (2 species)

7. Species Neisseria meningitidis [TaxId:487] [117331] (4 PDB entries)
   Uniprot Q57265

8. Domain d2zdra1: 2zdr A:282-349 [154398]
   Other proteins in same PDB: d2zdra2
   automated match to d1xuua1
   complexed with mg, mpd

Details for d2zdra1

PDB Entry: 2zdr, 1.85 Å

PDB Description: crystal structure of sialic acid synthase (neub) from neisseria meningitidis in complex with mg2+ and (4s)-2-methyl-2,4-pentanediol

PDB Compounds: (A:) Capsule biosynthesis protein

SCOPe Domain Sequences for d2zdra1:

Sequence; same for both SEQRES and ATOM records:

>d2zdra1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

Timeline for d2zdra1:

• d2zdra1 first appeared in SCOP 1.75
  
• d2zdra1 appears in SCOPe 2.06
  
• d2zdra1 does not appear in SCOPe 2.08