![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
![]() | Protein beta-Lactamase, class A [56606] (15 species) |
![]() | Species Klebsiella pneumoniae, SHV-2 [TaxId:573] [90082] (10 PDB entries) almost identical sequence to SHV-1 |
![]() | Domain d2zd8a_: 2zd8 A: [154391] automated match to d1n9ba_ complexed with ma4, mer |
PDB Entry: 2zd8 (more details), 1.05 Å
SCOPe Domain Sequences for d2zd8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zd8a_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]} spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd tpasmaernqqiagigaaliehwqr
Timeline for d2zd8a_: