Lineage for d2zd2a1 (2zd2 A:1005-1238)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617574Fold d.381: ATP12-like [160908] (1 superfamily)
    contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helices
  4. 2617575Superfamily d.381.1: ATP12-like [160909] (1 family) (S)
  5. 2617576Family d.381.1.1: ATP12-like [160910] (2 proteins)
    Pfam PF07542; F1-ATPase chaperone
  6. 2617577Protein ATP12 ATPase [160913] (1 species)
  7. 2617578Species Paracoccus denitrificans [TaxId:266] [160914] (3 PDB entries)
    Uniprot A1B060 2-235! Uniprot A1B060 3-235
  8. 2617582Domain d2zd2a1: 2zd2 A:1005-1238 [154389]
    mutant

Details for d2zd2a1

PDB Entry: 2zd2 (more details), 1.8 Å

PDB Description: d202k mutant of p. denitrificans atp12p
PDB Compounds: (A:) ATP12 ATPase

SCOPe Domain Sequences for d2zd2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zd2a1 d.381.1.1 (A:1005-1238) ATP12 ATPase {Paracoccus denitrificans [TaxId: 266]}
sewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqevi
dpnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdpli
dwaatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilgla
virgridaptahalsrikeefqaerwgrdeeaeaqaasrlaamrdserfwhltr

SCOPe Domain Coordinates for d2zd2a1:

Click to download the PDB-style file with coordinates for d2zd2a1.
(The format of our PDB-style files is described here.)

Timeline for d2zd2a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zd2b_