SCOPe 2.08: Domain d2zd0c_: 2zd0 C:

Lineage for d2zd0c_ (2zd0 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
   oligomeric ring consists of 11 single-domain subunits
   automatically mapped to Pfam PF02081

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)

8. Domain d2zd0c_: 2zd0 C: [154387]
   automated match to d1c9sm_
   complexed with trp; mutant

Details for d2zd0c_

PDB Entry: 2zd0, 2.5 Å

PDB Description: crystal structures and thermostability of mutant trap3 a5 (engineered trap)

PDB Compounds: (C:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d2zd0c_:

Sequence; same for both SEQRES and ATOM records:

>d2zd0c_ b.82.5.1 (C:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvies

Timeline for d2zd0c_:

• d2zd0c_ first appeared in SCOP 1.75, called d2zd0c1
  
• d2zd0c_ appears in SCOPe 2.07