SCOP 1.75: Domain d2zcze1: 2zcz E:7-74

Lineage for d2zcze1 (2zcz E:7-74)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
   oligomeric ring consists of 11 single-domain subunits

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51223] (10 PDB entries)

8. Domain d2zcze1: 2zcz E:7-74 [154383]
   automatically matched to d1c9sm_
   complexed with trp; mutant

Details for d2zcze1

PDB Entry: 2zcz, 1.8 Å

PDB Description: crystal structures and thermostability of mutant trap3 a7 (engineered trap)

PDB Compounds: (E:) transcription attenuation protein mtrb

SCOP Domain Sequences for d2zcze1:

Sequence; same for both SEQRES and ATOM records:

>d2zcze1 b.82.5.1 (E:7-74) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvieseg

Timeline for d2zcze1:

• d2zcze1 is new in SCOP 1.75
  
• d2zcze1 is called d2zcze_ in SCOPe 2.01
  
• d2zcze1 appears in the current release, SCOPe 2.08, called d2zcze_