Lineage for d2zcyz_ (2zcy Z:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2599677Domain d2zcyz_: 2zcy Z: [154378]
    Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcye_, d2zcyf_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcym_, d2zcyn_, d2zcyo_, d2zcys_, d2zcyt_, d2zcyw_, d2zcyx_, d2zcyy_
    automated match to d1g0ul_
    complexed with srg

Details for d2zcyz_

PDB Entry: 2zcy (more details), 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d2zcyz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcyz_ d.153.1.4 (Z:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d2zcyz_:

Click to download the PDB-style file with coordinates for d2zcyz_.
(The format of our PDB-style files is described here.)

Timeline for d2zcyz_: