SCOPe 2.01: Domain d1dxvd_: 1dxv D:

Lineage for d1dxvd_ (1dxv D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (196 PDB entries)
   Uniprot P68871

8. Domain d1dxvd_: 1dxv D: [15437]
   Other proteins in same PDB: d1dxva_, d1dxvc_
   complexed with hem, so4

Details for d1dxvd_

PDB Entry: 1dxv, 1.7 Å

PDB Description: high-resolution x-ray study of deoxy recombinant human hemoglobins synthesized from beta-globins having mutated amino termini

PDB Compounds: (D:) hemoglobin (deoxy) (beta chain)

SCOPe Domain Sequences for d1dxvd_:

Sequence; same for both SEQRES and ATOM records:

>d1dxvd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
ahltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1dxvd_:

• d1dxvd_ first appeared (with stable ids) in SCOP 1.55
  
• d1dxvd_ appears in SCOP 1.75
  
• d1dxvd_ appears in SCOPe 2.02
  
• d1dxvd_ appears in the current release, SCOPe 2.08