Lineage for d1dxvd_ (1dxv D:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208921Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 208970Species Human (Homo sapiens) [TaxId:9606] [46501] (95 PDB entries)
  8. 208997Domain d1dxvd_: 1dxv D: [15437]
    Other proteins in same PDB: d1dxva_, d1dxvc_
    complexed with hem, so4; mutant

Details for d1dxvd_

PDB Entry: 1dxv (more details), 1.8 Å

PDB Description: high-resolution x-ray study of deoxy recombinant human hemoglobins synthesized from beta-globins having mutated amino termini

SCOP Domain Sequences for d1dxvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxvd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
ahltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1dxvd_:

Click to download the PDB-style file with coordinates for d1dxvd_.
(The format of our PDB-style files is described here.)

Timeline for d1dxvd_: