![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (14 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
![]() | Domain d2zcyp_: 2zcy P: [154369] Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcyc3, d2zcye_, d2zcyf_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyq3, d2zcys_, d2zcyt_, d2zcyw_, d2zcyx_, d2zcyy_ automated match to d1g65b_ complexed with srg |
PDB Entry: 2zcy (more details), 2.9 Å
SCOPe Domain Sequences for d2zcyp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcyp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d2zcyp_:
![]() Domains from other chains: (mouse over for more information) d2zcy0_, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc2, d2zcyc3, d2zcyd_, d2zcye_, d2zcyf_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyq2, d2zcyq3, d2zcyr_, d2zcys_, d2zcyt_, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_ |