Lineage for d2zcyk1 (2zcy K:1-211)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (12 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 876314Domain d2zcyk1: 2zcy K:1-211 [154364]
    Other proteins in same PDB: d2zcya1, d2zcyb1, d2zcyc1, d2zcye1, d2zcyf1, d2zcyg1, d2zcyo1, d2zcyp1, d2zcyq1, d2zcys1, d2zcyt1, d2zcyu1
    automatically matched to d1g0uk_
    complexed with srg

Details for d2zcyk1

PDB Entry: 2zcy (more details), 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex
PDB Compounds: (K:) Proteasome component PRE2

SCOP Domain Sequences for d2zcyk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcyk1 d.153.1.4 (K:1-211) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOP Domain Coordinates for d2zcyk1:

Click to download the PDB-style file with coordinates for d2zcyk1.
(The format of our PDB-style files is described here.)

Timeline for d2zcyk1: