| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
| Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species) contains an extension to the common fold at the N-terminus |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (12 PDB entries) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) |
| Domain d2zcyg1: 2zcy G:6-240 [154360] Other proteins in same PDB: d2zcy01, d2zcy11, d2zcyh1, d2zcyi1, d2zcyj1, d2zcyk1, d2zcyl1, d2zcym1, d2zcyn1, d2zcyv1, d2zcyw1, d2zcyx1, d2zcyy1, d2zcyz1 automatically matched to d1g65g_ complexed with srg |
PDB Entry: 2zcy (more details), 2.9 Å
SCOP Domain Sequences for d2zcyg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcyg1 d.153.1.4 (G:6-240) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd
Timeline for d2zcyg1: