SCOP 1.65: Domain d1dxvb_: 1dxv B:

Lineage for d1dxvb_ (1dxv B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (100 PDB entries)

8. Domain d1dxvb_: 1dxv B: [15436]
   Other proteins in same PDB: d1dxva_, d1dxvc_

Details for d1dxvb_

PDB Entry: 1dxv, 1.8 Å

PDB Description: high-resolution x-ray study of deoxy recombinant human hemoglobins synthesized from beta-globins having mutated amino termini

SCOP Domain Sequences for d1dxvb_:

Sequence; same for both SEQRES and ATOM records:

>d1dxvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
ahltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1dxvb_:

• d1dxvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dxvb_ appears in SCOP 1.63
  
• d1dxvb_ appears in SCOP 1.67
  
• d1dxvb_ appears in the current release, SCOPe 2.08