SCOPe 2.07: Domain d2zcy1_: 2zcy 1:

Lineage for d2zcy1_ (2zcy 1:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2zcy1_: 2zcy 1: [154354]
   Other proteins in same PDB: d2zcya_, d2zcyb_, d2zcyc_, d2zcyd_, d2zcye_, d2zcyf_, d2zcyg_, d2zcyh_, d2zcyl_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyt_, d2zcyu_, d2zcyv_, d2zcyz_
   automated match to d1g0u2_
   complexed with srg

Details for d2zcy1_

PDB Entry: 2zcy, 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex

PDB Compounds: (1:) Proteasome component PRE3

SCOPe Domain Sequences for d2zcy1_:

Sequence; same for both SEQRES and ATOM records:

>d2zcy1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

Timeline for d2zcy1_:

• d2zcy1_ first appeared in SCOP 1.75, called d2zcy11
  
• d2zcy1_ appears in SCOPe 2.06
  
• d2zcy1_ appears in the current release, SCOPe 2.08