Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (23 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Peroxiredoxin [117601] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [117602] (5 PDB entries) Uniprot Q9Y9L0 # APE2278 |
Domain d2zcti1: 2zct I:5-242 [154351] automatically matched to d1x0ra1 mutant |
PDB Entry: 2zct (more details), 1.7 Å
SCOP Domain Sequences for d2zcti1:
Sequence, based on SEQRES records: (download)
>d2zcti1 c.47.1.10 (I:5-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} ipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedf qrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesatht vrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigeg livpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpaklly
>d2zcti1 c.47.1.10 (I:5-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} ipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedf qrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllathtvrgv fivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigeglivp ppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpaklly
Timeline for d2zcti1: