Lineage for d2zcga_ (2zcg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079288Protein automated matches [190130] (11 species)
    not a true protein
  7. 2079315Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [187245] (4 PDB entries)
  8. 2079316Domain d2zcga_: 2zcg A: [154341]
    automated match to d2f84a1

Details for d2zcga_

PDB Entry: 2zcg (more details), 2.22 Å

PDB Description: Structure and inhibition of orotidine 5'-phosphate decarboxylase from plasmodium falciparum
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2zcga_:

Sequence, based on SEQRES records: (download)

>d2zcga_ c.1.2.3 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd
illkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlkn
vfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydee
knkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvv
gansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpy
pqkaaqmyydqinailkqnm

Sequence, based on observed residues (ATOM records): (download)

>d2zcga_ c.1.2.3 (A:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd
illkapdniirkseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvf
dylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeekn
kyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfvvga
nsydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknpypq
kaaqmyydqinailkqnm

SCOPe Domain Coordinates for d2zcga_:

Click to download the PDB-style file with coordinates for d2zcga_.
(The format of our PDB-style files is described here.)

Timeline for d2zcga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2zcgb_