| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
| Protein Iron-containing nitrile hydratase [50102] (1 species) |
| Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries) also Rhodococcus sp. R312 |
| Domain d2zcfb_: 2zcf B: [154340] Other proteins in same PDB: d2zcfa_ automated match to d1ahjb_ complexed with fe, mg; mutant |
PDB Entry: 2zcf (more details), 1.43 Å
SCOPe Domain Sequences for d2zcfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcfb_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa
Timeline for d2zcfb_: