![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
![]() | Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) ![]() duplication: consists of 2 subdomains of this fold |
![]() | Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
![]() | Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
![]() | Domain d2zc3c1: 2zc3 C:626-692 [154325] Other proteins in same PDB: d2zc3b_, d2zc3e_ automated match to d2zc3c1 complexed with bmg, so4 |
PDB Entry: 2zc3 (more details), 2.5 Å
SCOPe Domain Sequences for d2zc3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc3c1 d.11.1.1 (C:626-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} aleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqq vlilsdk
Timeline for d2zc3c1:
![]() Domains from other chains: (mouse over for more information) d2zc3b_, d2zc3e_, d2zc3f1, d2zc3f2 |