SCOP 1.75: Domain d2zc3b1: 2zc3 B:264-619

Lineage for d2zc3b1 (2zc3 B:264-619)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)

6. Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [56625] (10 PDB entries)

8. Domain d2zc3b1: 2zc3 B:264-619 [154324]
   Other proteins in same PDB: d2zc3c1, d2zc3c2, d2zc3f1, d2zc3f2
   automatically matched to d1pmda4
   complexed with bmg, so4

Details for d2zc3b1

PDB Entry: 2zc3, 2.5 Å

PDB Description: Penicillin-binding protein 2X (PBP 2X) acyl-enzyme complex (biapenem) from Streptococcus pneumoniae

PDB Compounds: (B:) penicillin-binding protein 2x

SCOP Domain Sequences for d2zc3b1:

Sequence; same for both SEQRES and ATOM records:

>d2zc3b1 e.3.1.1 (B:264-619) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdsln

Timeline for d2zc3b1:

• d2zc3b1 is new in SCOP 1.75
  
• d2zc3b1 appears in SCOPe 2.01
  
• d2zc3b1 appears in the current release, SCOPe 2.08, called d2zc3b_