Lineage for d2zbna_ (2zbn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432970Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
    Pfam PF01878; DUF55
  6. 2432977Protein Hypothetical protein PH1033 [141706] (1 species)
  7. 2432978Species Pyrococcus horikoshii [TaxId:53953] [141707] (3 PDB entries)
    Uniprot O58764 1-145
  8. 2432980Domain d2zbna_: 2zbn A: [154322]
    automated match to d1wmma1

Details for d2zbna_

PDB Entry: 2zbn (more details), 2 Å

PDB Description: Crystal structure of PH1033 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) UPF0310 protein PH1033

SCOPe Domain Sequences for d2zbna_:

Sequence, based on SEQRES records: (download)

>d2zbna_ b.122.1.8 (A:) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw
smhffgkamrelpeedyklieklll

Sequence, based on observed residues (ATOM records): (download)

>d2zbna_ b.122.1.8 (A:) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkpggketypyrvkikpikigeinfkplindlkfiknkkrwsm
hffgkamrelpeedyklieklll

SCOPe Domain Coordinates for d2zbna_:

Click to download the PDB-style file with coordinates for d2zbna_.
(The format of our PDB-style files is described here.)

Timeline for d2zbna_: