SCOP 1.75: Domain d2zbna1: 2zbn A:1-145

Lineage for d2zbna1 (2zbn A:1-145)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.8: Atu2648/PH1033-like [141703] (6 proteins)
   Pfam PF01878; DUF55

6. Protein Hypothetical protein PH1033 [141706] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141707] (3 PDB entries)
   Uniprot O58764 1-145

8. Domain d2zbna1: 2zbn A:1-145 [154322]
   automatically matched to 2HD9 A:1-145

Details for d2zbna1

PDB Entry: 2zbn, 2 Å

PDB Description: Crystal structure of PH1033 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) UPF0310 protein PH1033

SCOP Domain Sequences for d2zbna1:

Sequence, based on SEQRES records:

>d2zbna1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw
smhffgkamrelpeedyklieklll

Sequence, based on observed residues (ATOM records):

>d2zbna1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkpggketypyrvkikpikigeinfkplindlkfiknkkrwsm
hffgkamrelpeedyklieklll

Timeline for d2zbna1:

• d2zbna1 is new in SCOP 1.75
  
• d2zbna1 is called d2zbna_ in SCOPe 2.01
  
• d2zbna1 appears in the current release, SCOPe 2.08, called d2zbna_