![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
![]() | Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
![]() | Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
![]() | Protein Calcium ATPase [81658] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (14 PDB entries) Uniprot P04191 |
![]() | Domain d2zbeb3: 2zbe B:361-599 [154311] Other proteins in same PDB: d2zbea1, d2zbea2, d2zbea4, d2zbeb1, d2zbeb2, d2zbeb4 automatically matched to d1iwoa3 complexed with bef, mg |
PDB Entry: 2zbe (more details), 3.8 Å
SCOPe Domain Sequences for d2zbeb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbeb3 d.220.1.1 (B:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d2zbeb3:
![]() Domains from other chains: (mouse over for more information) d2zbea1, d2zbea2, d2zbea3, d2zbea4 |