Lineage for d2zbeb1 (2zbe B:125-239)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426671Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2426672Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2426673Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2426674Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
    Uniprot P04191
  8. 2426726Domain d2zbeb1: 2zbe B:125-239 [154309]
    Other proteins in same PDB: d2zbea2, d2zbea3, d2zbea4, d2zbeb2, d2zbeb3, d2zbeb4
    automatically matched to d1iwoa1
    complexed with bef, mg

Details for d2zbeb1

PDB Entry: 2zbe (more details), 3.8 Å

PDB Description: Calcium pump crystal structure with bound BeF3 in the absence of calcium and TG
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2zbeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zbeb1 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d2zbeb1:

Click to download the PDB-style file with coordinates for d2zbeb1.
(The format of our PDB-style files is described here.)

Timeline for d2zbeb1: