SCOP 1.75: Domain d2zbeb1: 2zbe B:125-239

Lineage for d2zbeb1 (2zbe B:125-239)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (15 PDB entries)
   Uniprot P04191

8. Domain d2zbeb1: 2zbe B:125-239 [154309]
   Other proteins in same PDB: d2zbea2, d2zbea3, d2zbea4, d2zbeb2, d2zbeb3, d2zbeb4
   automatically matched to d1iwoa1
   complexed with ace, bef, mg

Details for d2zbeb1

PDB Entry: 2zbe, 3.8 Å

PDB Description: Calcium pump crystal structure with bound BeF3 in the absence of calcium and TG

PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d2zbeb1:

Sequence; same for both SEQRES and ATOM records:

>d2zbeb1 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d2zbeb1:

• d2zbeb1 is new in SCOP 1.75
  
• d2zbeb1 appears in SCOPe 2.01
  
• d2zbeb1 appears in the current release, SCOPe 2.08