![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) ![]() a distorted variant of double-helix |
![]() | Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
![]() | Protein Calcium ATPase, transduction domain A [81651] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (15 PDB entries) Uniprot P04191 |
![]() | Domain d2zbeb1: 2zbe B:125-239 [154309] Other proteins in same PDB: d2zbea2, d2zbea3, d2zbea4, d2zbeb2, d2zbeb3, d2zbeb4 automatically matched to d1iwoa1 complexed with ace, bef, mg |
PDB Entry: 2zbe (more details), 3.8 Å
SCOP Domain Sequences for d2zbeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbeb1 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d2zbeb1:
![]() Domains from other chains: (mouse over for more information) d2zbea1, d2zbea2, d2zbea3, d2zbea4 |