![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
![]() | Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) ![]() |
![]() | Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein) |
![]() | Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (14 PDB entries) Uniprot P04191 |
![]() | Domain d2zbea4: 2zbe A:1-124,A:240-343,A:751-994 [154308] Other proteins in same PDB: d2zbea1, d2zbea2, d2zbea3, d2zbeb1, d2zbeb2, d2zbeb3 automatically matched to d1iwoa4 complexed with bef, mg |
PDB Entry: 2zbe (more details), 3.8 Å
SCOPe Domain Sequences for d2zbea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbea4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d2zbea4:
![]() Domains from other chains: (mouse over for more information) d2zbeb1, d2zbeb2, d2zbeb3, d2zbeb4 |