Lineage for d2zbea4 (2zbe A:1-124,A:240-343,A:751-994)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888234Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 888235Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 888236Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 888237Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 888238Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (15 PDB entries)
    Uniprot P04191
  8. 888258Domain d2zbea4: 2zbe A:1-124,A:240-343,A:751-994 [154308]
    Other proteins in same PDB: d2zbea1, d2zbea2, d2zbea3, d2zbeb1, d2zbeb2, d2zbeb3
    automatically matched to d1iwoa4
    complexed with ace, bef, mg

Details for d2zbea4

PDB Entry: 2zbe (more details), 3.8 Å

PDB Description: Calcium pump crystal structure with bound BeF3 in the absence of calcium and TG
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d2zbea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zbea4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOP Domain Coordinates for d2zbea4:

Click to download the PDB-style file with coordinates for d2zbea4.
(The format of our PDB-style files is described here.)

Timeline for d2zbea4: