SCOPe 2.01: Domain d2zbea2: 2zbe A:344-360,A:600-750

Lineage for d2zbea2 (2zbe A:344-360,A:600-750)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins)
   interrupted by a large insertion, domain N

6. Protein Calcium ATPase, catalytic domain P [81655] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (14 PDB entries)
   Uniprot P04191

8. Domain d2zbea2: 2zbe A:344-360,A:600-750 [154306]
   Other proteins in same PDB: d2zbea1, d2zbea3, d2zbea4, d2zbeb1, d2zbeb3, d2zbeb4
   automatically matched to d1iwoa2
   complexed with bef, mg

Details for d2zbea2

PDB Entry: 2zbe, 3.8 Å

PDB Description: Calcium pump crystal structure with bound BeF3 in the absence of calcium and TG

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2zbea2:

Sequence; same for both SEQRES and ATOM records:

>d2zbea2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

Timeline for d2zbea2:

• d2zbea2 first appeared in SCOP 1.75
  
• d2zbea2 appears in SCOPe 2.02
  
• d2zbea2 appears in the current release, SCOPe 2.08