![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
![]() | Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) ![]() |
![]() | Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins) |
![]() | Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (42 PDB entries) Uniprot P04191 |
![]() | Domain d2zbda4: 2zbd A:1-124,A:240-343,A:751-994 [154304] Other proteins in same PDB: d2zbda1, d2zbda2, d2zbda3 automated match to d1wpga4 complexed with adp, alf, ca, mg, pc1 |
PDB Entry: 2zbd (more details), 2.4 Å
SCOPe Domain Sequences for d2zbda4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zbda4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d2zbda4: