SCOP 1.75: Domain d2zbda1: 2zbd A:125-239

Lineage for d2zbda1 (2zbd A:125-239)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (15 PDB entries)
   Uniprot P04191

8. Domain d2zbda1: 2zbd A:125-239 [154301]
   Other proteins in same PDB: d2zbda2, d2zbda3, d2zbda4
   automatically matched to d1iwoa1
   complexed with ace, adp, alf, ca, mg, pc1

Details for d2zbda1

PDB Entry: 2zbd, 2.4 Å

PDB Description: Crystal Structure of the SR Calcium Pump with Bound Aluminium Fluoride, ADP and Calcium

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d2zbda1:

Sequence; same for both SEQRES and ATOM records:

>d2zbda1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d2zbda1:

• d2zbda1 is new in SCOP 1.75
  
• d2zbda1 appears in SCOPe 2.01
  
• d2zbda1 appears in the current release, SCOPe 2.08