Lineage for d2zb2a_ (2zb2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142110Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 2142114Species Human (Homo sapiens) [TaxId:9606] [53768] (16 PDB entries)
  8. 2142141Domain d2zb2a_: 2zb2 A: [154299]
    automated match to d1fa9a_
    complexed with a46, glc, mes, mpd, plp

Details for d2zb2a_

PDB Entry: 2zb2 (more details), 2.45 Å

PDB Description: human liver glycogen phosphorylase a complexed with glcose and 5- chloro-n-[4-(1,2-dihydroxyethyl)phenyl]-1h-indole-2-carboxamide
PDB Compounds: (A:) Glycogen phosphorylase, liver form

SCOPe Domain Sequences for d2zb2a_:

Sequence, based on SEQRES records: (download)

>d2zb2a_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgd
yiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrg
agtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlp
ealerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinm
ahlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglae
liaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpss
mfdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiik
litsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkf
mlngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklv
idqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmv
lkniaasgkfssdrtikeyaqniwnveps

Sequence, based on observed residues (ATOM records): (download)

>d2zb2a_ c.87.1.4 (A:) Glycogen phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfgdyiqavld
rnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgagtvfdafpdq
vaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlv
ekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshav
ngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyv
kdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkrihe
ykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnn
dpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtm
dganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffsp
kqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfs
sdrtikeyaqniwnveps

SCOPe Domain Coordinates for d2zb2a_:

Click to download the PDB-style file with coordinates for d2zb2a_.
(The format of our PDB-style files is described here.)

Timeline for d2zb2a_: