Lineage for d2zaxa_ (2zax A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007940Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2007941Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2007942Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2008211Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2008212Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2008225Domain d2zaxa_: 2zax A: [154295]
    automated match to d1t87a_
    complexed with cam, hem, k, trs

Details for d2zaxa_

PDB Entry: 2zax (more details), 1.6 Å

PDB Description: crystal structure of ferric cytochrome p450cam
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d2zaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zaxa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2zaxa_:

Click to download the PDB-style file with coordinates for d2zaxa_.
(The format of our PDB-style files is described here.)

Timeline for d2zaxa_: