Lineage for d2zaxa1 (2zax A:10-414)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774742Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 774743Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 774744Family a.104.1.1: Cytochrome P450 [48265] (22 proteins)
  6. 774852Protein Cytochrome P450-CAM [48266] (1 species)
  7. 774853Species Pseudomonas putida [TaxId:303] [48267] (60 PDB entries)
    Uniprot P00183
  8. 774857Domain d2zaxa1: 2zax A:10-414 [154295]
    automatically matched to d1p2ya_
    complexed with cam, hem, k, trs

Details for d2zaxa1

PDB Entry: 2zax (more details), 1.6 Å

PDB Description: crystal structure of ferric cytochrome p450cam
PDB Compounds: (A:) Cytochrome P450-cam

SCOP Domain Sequences for d2zaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zaxa1 a.104.1.1 (A:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d2zaxa1:

Click to download the PDB-style file with coordinates for d2zaxa1.
(The format of our PDB-style files is described here.)

Timeline for d2zaxa1: