SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2zaxa_ (2zax A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005175Domain d2zaxa_: 2zax A: [154295]
    automated match to d1t87a_
    complexed with cam, hem, k, trs

Details for d2zaxa_

PDB Entry: 2zax (more details), 1.6 Å

PDB Description: Crystal Structure of Ferric Cytochrome P450cam
PDB Compounds: (A:) Cytochrome P450-cam

SCOPe Domain Sequences for d2zaxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zaxa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2zaxa_:

Click to download the PDB-style file with coordinates for d2zaxa_.
(The format of our PDB-style files is described here.)

Timeline for d2zaxa_: