| Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
| Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
| Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
| Protein automated matches [226961] (2 species) not a true protein |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [231929] (7 PDB entries) |
| Domain d2zafd2: 2zaf D:2-260 [154284] Other proteins in same PDB: d2zafa1, d2zafb1, d2zafc1, d2zafd1 automated match to d2c12a2 complexed with fad |
PDB Entry: 2zaf (more details), 2.5 Å
SCOPe Domain Sequences for d2zafd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zafd2 e.6.1.1 (D:2-260) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct
Timeline for d2zafd2: