SCOPe 2.05: Domain d2zafc1: 2zaf C:261-431

Lineage for d2zafc1 (2zaf C:261-431)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)

6. Protein automated matches [231931] (2 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [231932] (6 PDB entries)

8. Domain d2zafc1: 2zaf C:261-431 [154281]
   Other proteins in same PDB: d2zafa2, d2zafb2, d2zafc2, d2zafd2
   automated match to d2c0ua1
   complexed with fad

Details for d2zafc1

PDB Entry: 2zaf, 2.5 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase

PDB Compounds: (C:) nitroalkane oxidase

SCOPe Domain Sequences for d2zafc1:

Sequence; same for both SEQRES and ATOM records:

>d2zafc1 a.29.3.1 (C:261-431) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglkrrqmqrvmaledyepwaatygs

Timeline for d2zafc1:

• d2zafc1 first appeared in SCOP 1.75
  
• d2zafc1 appears in SCOPe 2.04
  
• d2zafc1 appears in SCOPe 2.06
  
• d2zafc1 appears in the current release, SCOPe 2.08