Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2zafb2 (2zaf B:2-260)

  1. Root: SCOP 1.75B
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 protein domains)
  6. Protein Nitroalkane oxidase [144026] (1 species)
  7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries)
    Uniprot Q8X1D8 2-260
  8. Domain d2zafb2: 2zaf B:2-260 [154280]
    Other proteins in same PDB: d2zafa1, d2zafb1, d2zafc1, d2zafd1
    automatically matched to d2c0ua2
    complexed with fad

Details for d2zafb2

PDB Entry: 2zaf (more details)
PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (B:) nitroalkane oxidase

SCOP Domain Sequences for d2zafb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zafb2 e.6.1.1 (B:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

SCOP Domain Coordinates for d2zafb2:

Click to download the PDB-style file with coordinates for d2zafb2.
(The format of our PDB-style files is described here.)

Timeline for d2zafb2:

d2zafb2 appears in SCOP 1.75A


d2zafb2
(click for larger image)


d2zafb2 in context of chain
Domains from same chain:
d2zafb1


d2zafb2 in context of PDB
Domains from other chains:
d2zafa1, d2zafa2, d2zafc1, d2zafc2, d2zafd1, d2zafd2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu