SCOPe 2.01: Domain d2zafb1: 2zaf B:261-430

Lineage for d2zafb1 (2zaf B:261-430)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 proteins)

6. Protein Nitroalkane oxidase [140471] (1 species)

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
   Uniprot Q8X1D8 261-430

8. Domain d2zafb1: 2zaf B:261-430 [154279]
   Other proteins in same PDB: d2zafa2, d2zafb2, d2zafc2, d2zafd2
   automatically matched to d2c0ua1
   complexed with fad

Details for d2zafb1

PDB Entry: 2zaf, 2.5 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase

PDB Compounds: (B:) nitroalkane oxidase

SCOPe Domain Sequences for d2zafb1:

Sequence; same for both SEQRES and ATOM records:

>d2zafb1 a.29.3.1 (B:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglkrrqmqrvmaledyepwaatyg

Timeline for d2zafb1:

• d2zafb1 first appeared in SCOP 1.75
  
• d2zafb1 appears in SCOPe 2.02
  
• d2zafb1 appears in the current release, SCOPe 2.08