Domain d2zafb1: 2zaf B:261-430

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d2zafb1 (2zaf B:261-430)

Root: SCOP 1.75B
Class a: All alpha proteins [46456] (284 folds)
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families)
multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains)
Protein Nitroalkane oxidase [140471] (1 species)
Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
Uniprot Q8X1D8 261-430
Domain d2zafb1: 2zaf B:261-430 [154279]
Other proteins in same PDB: d2zafa2, d2zafb2, d2zafc2, d2zafd2
automatically matched to d2c0ua1
complexed with fad

Details for d2zafb1

PDB Entry: 2zaf (more details)
PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (B:) nitroalkane oxidase

SCOP Domain Sequences for d2zafb1:
Sequence; same for both SEQRES and ATOM records: (download)

>d2zafb1 a.29.3.1 (B:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]} pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk syakdmsfprllnevmcyplfdggniglkrrqmqrvmaledyepwaatyg

SCOP Domain Coordinates for d2zafb1:

Click to download the PDB-style file with coordinates for d2zafb1.
(The format of our PDB-style files is described here.)

Timeline for d2zafb1:
d2zafb1 appears in SCOP 1.75A

d2zafb1
(click for larger image)

d2zafb1 in context of chain
Domains from same chain:
d2zafb2

d2zafb1 in context of PDB
Domains from other chains:
d2zafa1, d2zafa2, d2zafc1, d2zafc2, d2zafd1, d2zafd2