SCOPe 2.08: Domain d2zafa2: 2zaf A:2-260

Lineage for d2zafa2 (2zaf A:2-260)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein automated matches [226961] (2 species)
   not a true protein

7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [231929] (7 PDB entries)

8. Domain d2zafa2: 2zaf A:2-260 [154278]
   Other proteins in same PDB: d2zafa1, d2zafb1, d2zafc1, d2zafd1
   automated match to d2c12a2
   complexed with fad

Details for d2zafa2

PDB Entry: 2zaf, 2.5 Å

PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase

PDB Compounds: (A:) nitroalkane oxidase

SCOPe Domain Sequences for d2zafa2:

Sequence; same for both SEQRES and ATOM records:

>d2zafa2 e.6.1.1 (A:2-260) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]}
vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
gphtrftefhvphenllct

Timeline for d2zafa2:

• d2zafa2 first appeared in SCOP 1.75
  
• d2zafa2 appears in SCOPe 2.07