Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2zafa1 (2zaf A:261-430)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (9 protein domains)
  6. Protein Nitroalkane oxidase [140471] (1 species)
  7. Species Fungus (Fusarium oxysporum) [TaxId:5507] [140472] (4 PDB entries)
    Uniprot Q8X1D8 261-430
  8. Domain d2zafa1: 2zaf A:261-430 [154277]
    Other proteins in same PDB: d2zafa2, d2zafb2, d2zafc2, d2zafd2
    automatically matched to d2c0ua1
    complexed with fad

Details for d2zafa1

PDB Entry: 2zaf (more details)
PDB Description: mechanistic and structural analyses of the roles of arg409 and asp402 in the reaction of the flavoprotein nitroalkane oxidase
PDB Compounds: (A:) nitroalkane oxidase

SCOP Domain Sequences for d2zafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zafa1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
pglkaqglvetafamsaalvgamaigtaraafeealvfaksdtrggskhiiehqsvadkl
idckirletsrllvwkavttledealewkvklemamqtkiyttdvavecvidamkavgmk
syakdmsfprllnevmcyplfdggniglkrrqmqrvmaledyepwaatyg

SCOP Domain Coordinates for d2zafa1:

Click to download the PDB-style file with coordinates for d2zafa1.
(The format of our PDB-style files is described here.)

Timeline for d2zafa1:

d2zafa1 appears in SCOP 1.75A


d2zafa1
(click for larger image)


d2zafa1 in context of chain
Domains from same chain:
d2zafa2


d2zafa1 in context of PDB
Domains from other chains:
d2zafb1, d2zafb2, d2zafc1, d2zafc2, d2zafd1, d2zafd2


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu