Lineage for d2za8a_ (2za8 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911451Protein automated matches [190041] (18 species)
    not a true protein
  7. 911558Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)
  8. 911560Domain d2za8a_: 2za8 A: [154276]
    automated match to d1data_
    complexed with cd; mutant

Details for d2za8a_

PDB Entry: 2za8 (more details), 1.4 Å

PDB Description: recombinant horse L-chain apoferritin N-terminal deletion mutant (residues 1-8)
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2za8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za8a_ a.25.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
ysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekregaerllk
mqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqadphlcd
fleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk

SCOPe Domain Coordinates for d2za8a_:

Click to download the PDB-style file with coordinates for d2za8a_.
(The format of our PDB-style files is described here.)

Timeline for d2za8a_: