Lineage for d2za8a1 (2za8 A:9-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766021Protein (Apo)ferritin [47246] (7 species)
  7. 766079Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (20 PDB entries)
  8. 766081Domain d2za8a1: 2za8 A:9-172 [154276]
    automatically matched to d1data_
    complexed with cd; mutant

Details for d2za8a1

PDB Entry: 2za8 (more details), 1.4 Å

PDB Description: recombinant horse L-chain apoferritin N-terminal deletion mutant (residues 1-8)
PDB Compounds: (A:) ferritin light chain

SCOP Domain Sequences for d2za8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2za8a1 a.25.1.1 (A:9-172) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
ysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekregaerllk
mqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqadphlcd
fleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOP Domain Coordinates for d2za8a1:

Click to download the PDB-style file with coordinates for d2za8a1.
(The format of our PDB-style files is described here.)

Timeline for d2za8a1: