| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (9 proteins) |
| Protein (Apo)ferritin [47246] (7 species) |
| Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (20 PDB entries) |
| Domain d2za8a1: 2za8 A:9-172 [154276] automatically matched to d1data_ complexed with cd; mutant |
PDB Entry: 2za8 (more details), 1.4 Å
SCOP Domain Sequences for d2za8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2za8a1 a.25.1.1 (A:9-172) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
ysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekregaerllk
mqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqadphlcd
fleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl
Timeline for d2za8a1: